Recombinant Full Length Human NMI Protein, GST-tagged
Cat.No. : | NMI-6589HF |
Product Overview : | Human NMI full-length ORF ( AAH21987.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 307 amino acids |
Description : | NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. [provided by RefSeq |
Molecular Mass : | 61.5 kDa |
AA Sequence : | MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLRKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQPHIAYFEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NMI N-myc (and STAT) interactor [ Homo sapiens ] |
Official Symbol | NMI |
Synonyms | NMI; N-myc (and STAT) interactor; N-myc-interactor; N-myc interactor; |
Gene ID | 9111 |
mRNA Refseq | NM_004688 |
Protein Refseq | NP_004679 |
MIM | 603525 |
UniProt ID | Q13287 |
◆ Recombinant Proteins | ||
Nmi-4442M | Recombinant Mouse Nmi Protein, Myc/DDK-tagged | +Inquiry |
NMI-6589HF | Recombinant Full Length Human NMI Protein, GST-tagged | +Inquiry |
NMI-2876R | Recombinant Rhesus Macaque NMI Protein, His (Fc)-Avi-tagged | +Inquiry |
NMI-5682H | Recombinant Human NMI Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NMI-5935H | Recombinant Human NMI Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMI-3785HCL | Recombinant Human NMI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NMI Products
Required fields are marked with *
My Review for All NMI Products
Required fields are marked with *