Recombinant Full Length Human NMNAT1 Protein, C-Flag-tagged
Cat.No. : | NMNAT1-2171HFL |
Product Overview : | Recombinant Full Length Human NMNAT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme which catalyzes a key step in the biosynthesis of nicotinamide adenine dinucleotide (NAD). The encoded enzyme is one of several nicotinamide nucleotide adenylyltransferases, and is specifically localized to the cell nucleus. Activity of this protein leads to the activation of a nuclear deacetylase that functions in the protection of damaged neurons. Mutations in this gene have been associated with Leber congenital amaurosis 9. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are located on chromosomes 1, 3, 4, 14, and 15. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 31.8 kDa |
AA Sequence : | MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMA ELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQDSSQKKS LEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNI HVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Full Length : | Full L. |
Gene Name | NMNAT1 nicotinamide nucleotide adenylyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | NMNAT1 |
Synonyms | LCA9; NMNAT; PNAT1; SHILCA |
Gene ID | 64802 |
mRNA Refseq | NM_022787.4 |
Protein Refseq | NP_073624.2 |
MIM | 608700 |
UniProt ID | Q9HAN9 |
◆ Recombinant Proteins | ||
NMNAT1-26H | Active Recombinant Human NMNAT1, His-tagged | +Inquiry |
NMNAT1-25H | Active Recombinant Human NMNAT1, His-tagged | +Inquiry |
NMNAT1-7754H | Recombinant Human NMNAT1 protein, GST-tagged | +Inquiry |
NMNAT1-6280H | Recombinant Human NMNAT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NMNAT1-77H | Active Recombinant Human NMNAT1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMNAT1-001HCL | Recombinant Human NMNAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NMNAT1 Products
Required fields are marked with *
My Review for All NMNAT1 Products
Required fields are marked with *
0
Inquiry Basket