Recombinant Full Length Human NOL12 Protein, GST-tagged

Cat.No. : NOL12-6686HF
Product Overview : Human NOL12 full-length ORF ( NP_077289.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 213 amino acids
Description : NOL12 (Nucleolar Protein 12) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding and rRNA binding. An important paralog of this gene is ENSG00000100101.
Molecular Mass : 51.1 kDa
AA Sequence : MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARHSGE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOL12 nucleolar protein 12 [ Homo sapiens ]
Official Symbol NOL12
Synonyms NOL12; nucleolar protein 12; MGC3731; Nop25; RRP17; dJ37E16.7; FLJ34609;
Gene ID 79159
mRNA Refseq NM_024313
Protein Refseq NP_077289
UniProt ID Q9UGY1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOL12 Products

Required fields are marked with *

My Review for All NOL12 Products

Required fields are marked with *

0
cart-icon