Recombinant Full Length Human NOL12 Protein, GST-tagged
| Cat.No. : | NOL12-6686HF |
| Product Overview : | Human NOL12 full-length ORF ( NP_077289.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 213 amino acids |
| Description : | NOL12 (Nucleolar Protein 12) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding and rRNA binding. An important paralog of this gene is ENSG00000100101. |
| Molecular Mass : | 51.1 kDa |
| AA Sequence : | MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARHSGE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NOL12 nucleolar protein 12 [ Homo sapiens ] |
| Official Symbol | NOL12 |
| Synonyms | NOL12; nucleolar protein 12; MGC3731; Nop25; RRP17; dJ37E16.7; FLJ34609; |
| Gene ID | 79159 |
| mRNA Refseq | NM_024313 |
| Protein Refseq | NP_077289 |
| UniProt ID | Q9UGY1 |
| ◆ Recombinant Proteins | ||
| NOL12-3676R | Recombinant Rat NOL12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NOL12-5969H | Recombinant Human NOL12 Protein, GST-tagged | +Inquiry |
| NOL12-3649H | Recombinant Human NOL12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NOL12-4017R | Recombinant Rat NOL12 Protein | +Inquiry |
| NOL12-2882R | Recombinant Rhesus Macaque NOL12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NOL12-3769HCL | Recombinant Human NOL12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOL12 Products
Required fields are marked with *
My Review for All NOL12 Products
Required fields are marked with *
