Recombinant Full Length Human NOVA2 Protein, C-Flag-tagged
Cat.No. : | NOVA2-1131HFL |
Product Overview : | Recombinant Full Length Human NOVA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables sequence-specific mRNA binding activity. Involved in neuron differentiation and regulation of alternative mRNA splicing, via spliceosome. Predicted to be active in cytoplasm and nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48.8 kDa |
AA Sequence : | MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSK SKDFYPGTTERVCLVQGTAEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPDRAKQAKLIVPNS TAGLIIGKGGATVKAVMEQSGAWVQLSQKPEGINLQERVVTVSGEPEQVHKAVSAIVQKVQEDPQSSSCL NISYANVAGPVANSNPTGSPYASPADVLPAAAAASAAAASGLLGPAGLAGVGAFPAALPAFSGTDLLAIS TALNTLASYGYNTNSLGLGLNSAAASGVLAAVAAGANPAAAAAANLLASYAGEAGAGPAGGAAPPPPPPP GALGSFALAAAANGYLGAGAGGGAGGGGGPLVAAAAAAGAAGGFLTAEKLAAESAKELVEIAVPENLVGA ILGKGGKTLVEYQELTGARIQISKKGEFLPGTRNRRVTITGSPAATQAAQYLISQRVTYEQGVRASNPQK VGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NOVA2 NOVA alternative splicing regulator 2 [ Homo sapiens (human) ] |
Official Symbol | NOVA2 |
Synonyms | ANOVA; NOVA3; NEDASB; NOVA-2 |
Gene ID | 4858 |
mRNA Refseq | NM_002516.4 |
Protein Refseq | NP_002507.1 |
MIM | 601991 |
UniProt ID | Q9UNW9 |
◆ Recombinant Proteins | ||
NOVA2-6721HF | Recombinant Full Length Human NOVA2 Protein, GST-tagged | +Inquiry |
NOVA2-6005H | Recombinant Human NOVA2 Protein, GST-tagged | +Inquiry |
NOVA2-570H | Recombinant Human NOVA2 | +Inquiry |
NOVA2-1528H | Recombinant Human NOVA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOVA2-3670H | Recombinant Human NOVA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOVA2 Products
Required fields are marked with *
My Review for All NOVA2 Products
Required fields are marked with *