Recombinant Full Length Human NP Protein, GST-tagged

Cat.No. : NP-6725HF
Product Overview : Human NP full-length ORF ( NP_000261.1, 1 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 289 amino acids
Description : This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. [provided by RefSeq
Molecular Mass : 58.5 kDa
AA Sequence : MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PNP purine nucleoside phosphorylase [ Homo sapiens (human) ]
Official Symbol NP
Synonyms PNP; purine nucleoside phosphorylase; NP; PUNP; PRO1837; purine nucleoside phosphorylase; HEL-S-156an; epididymis secretory sperm binding protein Li 156an; inosine phosphorylase; inosine-guanosine phosphorylase; purine-nucleoside:orthophosphate ribosyltransferase; EC 2.4.2.1
Gene ID 4860
mRNA Refseq NM_000270
Protein Refseq NP_000261
MIM 164050
UniProt ID P00491

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NP Products

Required fields are marked with *

My Review for All NP Products

Required fields are marked with *

0
cart-icon