Recombinant Full Length Human NP Protein, GST-tagged
Cat.No. : | NP-6725HF |
Product Overview : | Human NP full-length ORF ( NP_000261.1, 1 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 289 amino acids |
Description : | This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2. [provided by RefSeq |
Molecular Mass : | 58.5 kDa |
AA Sequence : | MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PNP purine nucleoside phosphorylase [ Homo sapiens (human) ] |
Official Symbol | NP |
Synonyms | PNP; purine nucleoside phosphorylase; NP; PUNP; PRO1837; purine nucleoside phosphorylase; HEL-S-156an; epididymis secretory sperm binding protein Li 156an; inosine phosphorylase; inosine-guanosine phosphorylase; purine-nucleoside:orthophosphate ribosyltransferase; EC 2.4.2.1 |
Gene ID | 4860 |
mRNA Refseq | NM_000270 |
Protein Refseq | NP_000261 |
MIM | 164050 |
UniProt ID | P00491 |
◆ Cell & Tissue Lysates | ||
NP-001SCL | Recombinant SARS NP cell lysate | +Inquiry |
NP-479HCL | Recombinant H2N2 NP cell lysate | +Inquiry |
NP-002HCL | Recombinant H3N2 NP cell lysate | +Inquiry |
NP-005HCL | Recombinant H7N9 NP cell lysate | +Inquiry |
NP-004HCL | Recombinant H5N1 NP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NP Products
Required fields are marked with *
My Review for All NP Products
Required fields are marked with *
0
Inquiry Basket