Recombinant Full Length Human NPFF Protein, GST-tagged
Cat.No. : | NPFF-6617HF |
Product Overview : | Human NPFF full-length ORF ( AAI04235.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 116 amino acids |
Description : | FMFRamide-related protein precursor plays a role in the regulation of heart rate and blood pressure and the modulation of morphine-induced antinociception. FMRFAL encodes a preproprotein which is cleaved to form two active peptides with similar function. [provided by RefSeq |
Molecular Mass : | 39.4 kDa |
AA Sequence : | MVPQPPTTCPWKPVPSPCDLRVQGICPSSFPDTPLAQEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPFF neuropeptide FF-amide peptide precursor [ Homo sapiens ] |
Official Symbol | NPFF |
Synonyms | NPFF; neuropeptide FF-amide peptide precursor; FMRFamide-related peptides; FMRFAL; |
Gene ID | 8620 |
mRNA Refseq | NM_003717 |
Protein Refseq | NP_003708 |
MIM | 604643 |
UniProt ID | O15130 |
◆ Recombinant Proteins | ||
NPFF-10816M | Recombinant Mouse NPFF Protein | +Inquiry |
NPFF-6617HF | Recombinant Full Length Human NPFF Protein, GST-tagged | +Inquiry |
NPFF-6156M | Recombinant Mouse NPFF Protein, His (Fc)-Avi-tagged | +Inquiry |
NPFF-3662H | Recombinant Human NPFF Protein, His (Fc)-Avi-tagged | +Inquiry |
Npff-1841M | Recombinant Mouse Npff Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPFF-3743HCL | Recombinant Human NPFF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPFF Products
Required fields are marked with *
My Review for All NPFF Products
Required fields are marked with *