Recombinant Full Length Human NPFF Protein, GST-tagged

Cat.No. : NPFF-6617HF
Product Overview : Human NPFF full-length ORF ( AAI04235.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 116 amino acids
Description : FMFRamide-related protein precursor plays a role in the regulation of heart rate and blood pressure and the modulation of morphine-induced antinociception. FMRFAL encodes a preproprotein which is cleaved to form two active peptides with similar function. [provided by RefSeq
Molecular Mass : 39.4 kDa
AA Sequence : MVPQPPTTCPWKPVPSPCDLRVQGICPSSFPDTPLAQEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPFF neuropeptide FF-amide peptide precursor [ Homo sapiens ]
Official Symbol NPFF
Synonyms NPFF; neuropeptide FF-amide peptide precursor; FMRFamide-related peptides; FMRFAL;
Gene ID 8620
mRNA Refseq NM_003717
Protein Refseq NP_003708
MIM 604643
UniProt ID O15130

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPFF Products

Required fields are marked with *

My Review for All NPFF Products

Required fields are marked with *

0
cart-icon