Recombinant Full Length Human NPL Protein, GST-tagged

• Cat.No.: NPL-6626HF
• Product Overview: Human NPL full-length ORF ( AAH58003.1, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 240 amino acids
• Description: N-acetylneuraminate pyruvate lyase (EC 4.1.3.3) controls the cellular concentration of sialic acid by catalyzing the conversion of sialic acid into acylmannosamines and pyruvate (Wu et al., 2005 [PubMed 16147865]).[supplied by OMIM
• Molecular Mass: 53.2 kDa
• AA Sequence: MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEFCIQRFINFVVKLENSKLKVSKNQRTLPLGTTNFPFLH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NPL N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase) [ Homo sapiens ]
• Official Symbol: NPL
• Synonyms: NPL; N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase); C1orf13, chromosome 1 open reading frame 13; N-acetylneuraminate lyase; DHDPS1; dihydrodipicolinate synthetase homolog 1 (E. coli); NPL1; NALase; sialic acid aldolase; sialate-pyruvate lyase; N-acetylneuraminic acid aldolase; dihydrodipicolinate synthetase homolog 1; NAL; C112; C1orf13; MGC61869; MGC149582
• Gene ID: 80896
• mRNA Refseq: NM_001200050
• Protein Refseq: NP_001186979
• MIM: 611412
• UniProt ID: Q9BXD5