Recombinant Full Length Human NPM2 Protein, GST-tagged
Cat.No. : | NPM2-6638HF |
Product Overview : | Human NPM2 full-length ORF ( NP_877724.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 214 amino acids |
Description : | NPM2 (Nucleophosmin/Nucleoplasmin 2) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and enzyme binding. An important paralog of this gene is NPM1. |
Molecular Mass : | 50.6 kDa |
AA Sequence : | MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPM2 nucleophosmin/nucleoplasmin 2 [ Homo sapiens ] |
Official Symbol | NPM2 |
Synonyms | NPM2; nucleophosmin/nucleoplasmin 2; nucleoplasmin-2; MGC78655; |
Gene ID | 10361 |
mRNA Refseq | NM_182795 |
Protein Refseq | NP_877724 |
MIM | 608073 |
UniProt ID | Q86SE8 |
◆ Recombinant Proteins | ||
NPM2-6614Z | Recombinant Zebrafish NPM2 | +Inquiry |
Npm2-1844M | Recombinant Mouse Npm2 Protein, His-tagged | +Inquiry |
NPM2-6038H | Recombinant Human NPM2 Protein, GST-tagged | +Inquiry |
NPM2-2501H | Recombinant Human NPM2 Protein, His-tagged | +Inquiry |
NPM2-6638HF | Recombinant Full Length Human NPM2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPM2-1212HCL | Recombinant Human NPM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPM2 Products
Required fields are marked with *
My Review for All NPM2 Products
Required fields are marked with *
0
Inquiry Basket