Recombinant Full Length Human NPM3 Protein, GST-tagged
Cat.No. : | NPM3-6640HF |
Product Overview : | Human NPM3 full-length ORF ( NP_008924.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 178 amino acids |
Description : | The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. [provided by RefSeq |
Molecular Mass : | 45.7 kDa |
AA Sequence : | MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPM3 nucleophosmin/nucleoplasmin 3 [ Homo sapiens ] |
Official Symbol | NPM3 |
Synonyms | NPM3; nucleophosmin/nucleoplasmin 3; nucleoplasmin-3; nucleophosmin/nucleoplasmin family, member 3; PORMIN; TMEM123; |
Gene ID | 10360 |
mRNA Refseq | NM_006993 |
Protein Refseq | NP_008924 |
MIM | 606456 |
UniProt ID | O75607 |
◆ Recombinant Proteins | ||
NPM3-6640HF | Recombinant Full Length Human NPM3 Protein, GST-tagged | +Inquiry |
NPM3-6039H | Recombinant Human NPM3 Protein, GST-tagged | +Inquiry |
NPM3-2161Z | Recombinant Zebrafish NPM3 | +Inquiry |
NPM3-1418H | Recombinant Human Nucleophosmin/nucleoplasmin 3, GST-tagged | +Inquiry |
Npm3-4475M | Recombinant Mouse Npm3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPM3-3736HCL | Recombinant Human NPM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPM3 Products
Required fields are marked with *
My Review for All NPM3 Products
Required fields are marked with *
0
Inquiry Basket