Recombinant Full Length Human NPM3 Protein, GST-tagged

Cat.No. : NPM3-6640HF
Product Overview : Human NPM3 full-length ORF ( NP_008924.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 178 amino acids
Description : The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. [provided by RefSeq
Molecular Mass : 45.7 kDa
AA Sequence : MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPM3 nucleophosmin/nucleoplasmin 3 [ Homo sapiens ]
Official Symbol NPM3
Synonyms NPM3; nucleophosmin/nucleoplasmin 3; nucleoplasmin-3; nucleophosmin/nucleoplasmin family, member 3; PORMIN; TMEM123;
Gene ID 10360
mRNA Refseq NM_006993
Protein Refseq NP_008924
MIM 606456
UniProt ID O75607

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPM3 Products

Required fields are marked with *

My Review for All NPM3 Products

Required fields are marked with *

0
cart-icon