| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-134 aa |
| Description : |
This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. The presence of myocardial injury is a significant predictor of mortality in hospitalized coronavirus disease 2019 (COVID-19) patients, and there is evidence of increased levels of natriuretic peptide B in hospitalized non-survivor COVID-19 patients. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Mutations in this gene have been associated with postmenopausal osteoporosis. |
| Form : |
Liquid in Phosphate-Buffered Saline (pH 7.4) 40% glycerol, 2mM DTT, 0.1mM PMSF, 1mM EDTA |
| Molecular Mass : |
14 kDa (129aa) confirmed by MALDI-TOF |
| AASequence : |
< MGSSHHHHHHSSGLVPRGSHM>HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 85% by SDS-PAGE |
| Applications : |
SDS-PAGE |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.5 mg/mL (determined by Bradford assay) |
| Reference : |
1. Harada H., et al. (1989) Cell. 58(4):729-739
2. Matsuyama T., et al. (1993) Cell 75(1):83-97 |
