Recombinant Full Length Human NPY1R Protein
| Cat.No. : | NPY1R-6655HF |
| Product Overview : | Human NPY1R full-length ORF (AAH71720.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 113 amino acids |
| Description : | Neuropeptide Y (NPY; MIM 162640) is one of the most abundant neuropeptides in the mammalian nervous system and exhibits a diverse range of important physiologic activities, including effects on psychomotor activity, food intake, regulation of central endocrine secretion, and potent vasoactive effects on the cardiovascular system. Two major subtypes of NPY (Y1 and Y2) have been defined by pharmacologic criteria. NPY receptors, such as NPY1R, have been identified in a variety of tissues, including brain, spleen, small intestine, kidney, testis, placenta, and aortic smooth muscle (Herzog et al., 1992 [PubMed 1321422]).[supplied by OMIM |
| Form : | Liquid |
| Molecular Mass : | 44.4 kDa |
| AA Sequence : | MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | NPY1R neuropeptide Y receptor Y1 [ Homo sapiens ] |
| Official Symbol | NPY1R |
| Synonyms | NPY1R; neuropeptide Y receptor Y1; NPYR; neuropeptide Y receptor type 1; NPY1-R; |
| Gene ID | 4886 |
| mRNA Refseq | NM_000909 |
| Protein Refseq | NP_000900 |
| MIM | 162641 |
| UniProt ID | P25929 |
| ◆ Recombinant Proteins | ||
| NPY1R-10846M | Recombinant Mouse NPY1R Protein | +Inquiry |
| RFL10154XF | Recombinant Full Length Xenopus Laevis Neuropeptide Y Receptor Type 1(Npy1R) Protein, His-Tagged | +Inquiry |
| RFL244SF | Recombinant Full Length Pig Neuropeptide Y Receptor Type 1(Npy1R) Protein, His-Tagged | +Inquiry |
| NPY1R-3179C | Recombinant Chicken NPY1R | +Inquiry |
| NPY1R-6655HF | Recombinant Full Length Human NPY1R Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPY1R-1214HCL | Recombinant Human NPY1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPY1R Products
Required fields are marked with *
My Review for All NPY1R Products
Required fields are marked with *
