Recombinant Full Length Human NPY5R Protein
| Cat.No. : | NPY5R-6663HF |
| Product Overview : | Human NPY5R full-length ORF (NP_006165.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 458 amino acids |
| Description : | The protein encoded by this gene is a receptor for neuropeptide Y and peptide YY. The encoded protein appears to be involved in regulating food intake, with defects in this gene being associated with eating disorders. Also, the encoded protein is involved in a pathway that protects neuroblastoma cells from chemotherapy-induced cell death, providing a possible therapeutic target against neuroblastoma. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2015] |
| Form : | Liquid |
| Molecular Mass : | 50.7 kDa |
| AA Sequence : | MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | NPY5R neuropeptide Y receptor Y5 [ Homo sapiens ] |
| Official Symbol | NPY5R |
| Synonyms | NPYR5; NPY5-R; NPYY5-R |
| Gene ID | 4889 |
| mRNA Refseq | NM_006174 |
| Protein Refseq | NP_006165 |
| MIM | 602001 |
| UniProt ID | Q15761 |
| ◆ Recombinant Proteins | ||
| RFL7934MF | Recombinant Full Length Mouse Neuropeptide Y Receptor Type 5(Npy5R) Protein, His-Tagged | +Inquiry |
| NPY5R-3089R | Recombinant Rhesus monkey NPY5R Protein, His-tagged | +Inquiry |
| NPY5R-3716R | Recombinant Rat NPY5R Protein, His (Fc)-Avi-tagged | +Inquiry |
| NPY5R-6178M | Recombinant Mouse NPY5R Protein, His (Fc)-Avi-tagged | +Inquiry |
| NPY5R-2802C | Recombinant Chicken NPY5R | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPY5R-1215HCL | Recombinant Human NPY5R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPY5R Products
Required fields are marked with *
My Review for All NPY5R Products
Required fields are marked with *
