Recombinant Full Length Human NPY5R Protein, GST-tagged
| Cat.No. : | NPY5R-6665HF |
| Product Overview : | Human NPY5R full-length ORF ( AAH42416, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 445 amino acids |
| Description : | The protein encoded by this gene is a receptor for neuropeptide Y and peptide YY. The encoded protein appears to be involved in regulating food intake, with defects in this gene being associated with eating disorders. Also, the encoded protein is involved in a pathway that protects neuroblastoma cells from chemotherapy-induced cell death, providing a possible therapeutic target against neuroblastoma. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2015] |
| Molecular Mass : | 74.69 kDa |
| AA Sequence : | MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NPY5R neuropeptide Y receptor Y5 [ Homo sapiens ] |
| Official Symbol | NPY5R |
| Synonyms | NPYR5; NPY5-R; NPYY5-R |
| Gene ID | 4889 |
| mRNA Refseq | NM_006174 |
| Protein Refseq | NP_006165 |
| MIM | 602001 |
| UniProt ID | Q15761 |
| ◆ Recombinant Proteins | ||
| NPY5R-2802C | Recombinant Chicken NPY5R | +Inquiry |
| NPY5R-3089R | Recombinant Rhesus monkey NPY5R Protein, His-tagged | +Inquiry |
| NPY5R-6060H | Recombinant Human NPY5R Protein | +Inquiry |
| NPY5R-6665HF | Recombinant Full Length Human NPY5R Protein, GST-tagged | +Inquiry |
| NPY5R-301329H | Recombinant Human NPY5R protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPY5R-1215HCL | Recombinant Human NPY5R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPY5R Products
Required fields are marked with *
My Review for All NPY5R Products
Required fields are marked with *
