Recombinant Full Length Human NR1D2 Protein, GST-tagged

Cat.No. : NR1D2-6693HF
Product Overview : Human NR1D2 full-length ORF ( AAH45613, 1 a.a. - 579 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 579 amino acids
Description : This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described. [provided by RefSeq
Molecular Mass : 89.21 kDa
AA Sequence : MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NR1D2 nuclear receptor subfamily 1, group D, member 2 [ Homo sapiens ]
Official Symbol NR1D2
Synonyms NR1D2; nuclear receptor subfamily 1, group D, member 2; nuclear receptor subfamily 1 group D member 2; BD73; EAR 1r; Hs.37288; HZF2; RVR; rev-erb-beta; rev-erba-alpha-related receptor; V-erbA-related protein 1-related; orphan nuclear hormone receptor BD73; nuclear receptor Rev-ErbA beta variant 1; nuclear receptor Rev-ErbA beta variant 2; EAR-1R;
Gene ID 9975
mRNA Refseq NM_001145425
Protein Refseq NP_001138897
MIM 602304
UniProt ID Q14995

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NR1D2 Products

Required fields are marked with *

My Review for All NR1D2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon