Recombinant Full Length Human NR2E3 Protein, GST-tagged

Cat.No. : NR2E3-6739HF
Product Overview : Human NR2E3 full-length ORF ( AAH41421, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 322 amino acids
Description : This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Molecular Mass : 61.16 kDa
AA Sequence : MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NR2E3 nuclear receptor subfamily 2, group E, member 3 [ Homo sapiens ]
Official Symbol NR2E3
Synonyms NR2E3; nuclear receptor subfamily 2, group E, member 3; photoreceptor-specific nuclear receptor; PNR; rd7; RP37; retina-specific nuclear receptor; photoreceptor cell-specific nuclear receptor variant 1; RNR; ESCS; MGC49976;
Gene ID 10002
mRNA Refseq NM_014249
Protein Refseq NP_055064
MIM 604485
UniProt ID Q9Y5X4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NR2E3 Products

Required fields are marked with *

My Review for All NR2E3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon