Recombinant Full Length Human NR2E3 Protein, GST-tagged
Cat.No. : | NR2E3-6739HF |
Product Overview : | Human NR2E3 full-length ORF ( AAH41421, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 322 amino acids |
Description : | This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq |
Molecular Mass : | 61.16 kDa |
AA Sequence : | MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NR2E3 nuclear receptor subfamily 2, group E, member 3 [ Homo sapiens ] |
Official Symbol | NR2E3 |
Synonyms | NR2E3; nuclear receptor subfamily 2, group E, member 3; photoreceptor-specific nuclear receptor; PNR; rd7; RP37; retina-specific nuclear receptor; photoreceptor cell-specific nuclear receptor variant 1; RNR; ESCS; MGC49976; |
Gene ID | 10002 |
mRNA Refseq | NM_014249 |
Protein Refseq | NP_055064 |
MIM | 604485 |
UniProt ID | Q9Y5X4 |
◆ Recombinant Proteins | ||
NR2E3-7846H | Recombinant Human NR2E3 protein, His-tagged | +Inquiry |
NR2E3-1358H | Recombinant Human NR2E3, His-tagged | +Inquiry |
Nr2e3-4490M | Recombinant Mouse Nr2e3 Protein, Myc/DDK-tagged | +Inquiry |
NR2E3-1583H | Recombinant Human NR2E3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NR2E3-6083H | Recombinant Human NR2E3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR2E3-3711HCL | Recombinant Human NR2E3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR2E3 Products
Required fields are marked with *
My Review for All NR2E3 Products
Required fields are marked with *
0
Inquiry Basket