Recombinant Full Length Human NRARP Protein, GST-tagged

Cat.No. : NRARP-6749HF
Product Overview : Human NRARP full-length ORF ( NP_001004354.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 114 amino acids
Description : NRARP (NOTCH Regulated Ankyrin Repeat Protein) is a Protein Coding gene. Among its related pathways are Notch signaling pathway (KEGG).
Molecular Mass : 38.9 kDa
AA Sequence : MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NRARP NOTCH-regulated ankyrin repeat protein [ Homo sapiens ]
Official Symbol NRARP
Synonyms NRARP; NOTCH-regulated ankyrin repeat protein; notch-regulated ankyrin repeat-containing protein; MGC61598;
Gene ID 441478
mRNA Refseq NM_001004354
Protein Refseq NP_001004354
MIM 619987
UniProt ID Q7Z6K4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRARP Products

Required fields are marked with *

My Review for All NRARP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon