Recombinant Full Length Human NRBF2 Protein, GST-tagged

Cat.No. : NRBF2-6751HF
Product Overview : Human NRBF2 full-length ORF ( AAH11707, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 287 amino acids
Description : NRBF2 (Nuclear Receptor Binding Factor 2) is a Protein Coding gene. Among its related pathways are Gene Expression and Nuclear Receptor transcription pathway.
Molecular Mass : 57.31 kDa
AA Sequence : MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIAKEPDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NRBF2 nuclear receptor binding factor 2 [ Homo sapiens ]
Official Symbol NRBF2
Synonyms NRBF2; nuclear receptor binding factor 2; nuclear receptor-binding factor 2; COPR1; COPR2; DKFZp564C1664; FLJ30395; comodulator of PPAR and RXR; nuclear receptor binding factor-2; NRBF-2;
Gene ID 29982
mRNA Refseq NM_030759
Protein Refseq NP_110386
MIM 616477
UniProt ID Q96F24

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRBF2 Products

Required fields are marked with *

My Review for All NRBF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon