Recombinant Full Length Human NRBF2 Protein, GST-tagged
| Cat.No. : | NRBF2-6751HF |
| Product Overview : | Human NRBF2 full-length ORF ( AAH11707, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 287 amino acids |
| Description : | NRBF2 (Nuclear Receptor Binding Factor 2) is a Protein Coding gene. Among its related pathways are Gene Expression and Nuclear Receptor transcription pathway. |
| Molecular Mass : | 57.31 kDa |
| AA Sequence : | MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIAKEPDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NRBF2 nuclear receptor binding factor 2 [ Homo sapiens ] |
| Official Symbol | NRBF2 |
| Synonyms | NRBF2; nuclear receptor binding factor 2; nuclear receptor-binding factor 2; COPR1; COPR2; DKFZp564C1664; FLJ30395; comodulator of PPAR and RXR; nuclear receptor binding factor-2; NRBF-2; |
| Gene ID | 29982 |
| mRNA Refseq | NM_030759 |
| Protein Refseq | NP_110386 |
| MIM | 616477 |
| UniProt ID | Q96F24 |
| ◆ Recombinant Proteins | ||
| NRBF2-2316H | Recombinant Human NRBF2, His-tagged | +Inquiry |
| Nrbf2-4495M | Recombinant Mouse Nrbf2 Protein, Myc/DDK-tagged | +Inquiry |
| NRBF2-6108H | Recombinant Human NRBF2 Protein, GST-tagged | +Inquiry |
| NRBF2-353H | Recombinant Human NRBF2, His & GST-tagged | +Inquiry |
| NRBF2-3098R | Recombinant Rhesus monkey NRBF2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NRBF2-001HCL | Recombinant Human NRBF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRBF2 Products
Required fields are marked with *
My Review for All NRBF2 Products
Required fields are marked with *
