Recombinant Full Length Human NRGN Protein, His tagged
Cat.No. : | NRGN-10HFL |
Product Overview : | Recombinant human NRGN protein, fused to Histag at N-terminus, was expressed in E. coli and purified by using conventional chromatography. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-78aa |
Description : | Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. |
Tag : | N-His |
Form : | Liquid |
Molecular Mass : | 10 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by BCA assay) |
Storage Buffer : | 20mM Tris-HCl buffer (pH7.0) containing 30% glycerol 0.1mM PMSF,1mM EDTA |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Gene Name | NRGN neurogranin (protein kinase C substrate, RC3) [ Homo sapiens (human) ] |
Official Symbol | NRGN |
Synonyms | NRGN; RC3; hng; neurogranin (protein kinase C substrate, RC3); neurogranin; ng; calmodulin-binding protein; protein kinase C substrate |
Gene ID | 4900 |
mRNA Refseq | NM_001126181 |
Protein Refseq | NP_001119653 |
MIM | 602350 |
UniProt ID | Q92686 |
◆ Recombinant Proteins | ||
NRGN-10HFL | Recombinant Full Length Human NRGN Protein, His tagged | +Inquiry |
NRGN-4185H | Recombinant Human NRGN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NRGN-2920R | Recombinant Rhesus Macaque NRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
NRGN-6201M | Recombinant Mouse NRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
NRGN-6831HF | Recombinant Full Length Human NRGN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRGN-3696HCL | Recombinant Human NRGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRGN Products
Required fields are marked with *
My Review for All NRGN Products
Required fields are marked with *