Recombinant Full Length Human NSFL1C Protein, C-Flag-tagged
Cat.No. : | NSFL1C-2015HFL |
Product Overview : | Recombinant Full Length Human NSFL1C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | N-ethylmaleimide-sensitive factor (NSF) and valosin-containing protein (p97) are two ATPases known to be involved in transport vesicle/target membrane fusion and fusions between membrane compartments. A trimer of the protein encoded by this gene binds a hexamer of cytosolic p97 and is required for p97-mediated regrowth of Golgi cisternae from mitotic Golgi fragments. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.4 kDa |
AA Sequence : | MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGTAPSDN RVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKS PGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDVHVVLKLWKSGFSLDNGELRSYQDPSNAQFL ESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENE AKASSSILIDESEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELAD ESQTLKEANLLNAVIVQRLT myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NSFL1C NSFL1 cofactor [ Homo sapiens (human) ] |
Official Symbol | NSFL1C |
Synonyms | P47; UBX1; UBXD10; UBXN2C; dJ776F14.1 |
Gene ID | 55968 |
mRNA Refseq | NM_016143.5 |
Protein Refseq | NP_057227.2 |
MIM | 606610 |
UniProt ID | Q9UNZ2 |
◆ Recombinant Proteins | ||
NSFL1C-1822Z | Recombinant Zebrafish NSFL1C | +Inquiry |
Nsfl1c-4507M | Recombinant Mouse Nsfl1c Protein, Myc/DDK-tagged | +Inquiry |
NSFL1C-3753R | Recombinant Rat NSFL1C Protein, His (Fc)-Avi-tagged | +Inquiry |
NSFL1C-2928R | Recombinant Rhesus Macaque NSFL1C Protein, His (Fc)-Avi-tagged | +Inquiry |
NSFL1C-4092R | Recombinant Rat NSFL1C Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NSFL1C-3687HCL | Recombinant Human NSFL1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NSFL1C Products
Required fields are marked with *
My Review for All NSFL1C Products
Required fields are marked with *
0
Inquiry Basket