Recombinant Full Length Human NUCB1 Protein, C-Flag-tagged
Cat.No. : | NUCB1-2052HFL |
Product Overview : | Recombinant Full Length Human NUCB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of a small calcium-binding EF-hand protein family. The encoded protein is thought to have a key role in Golgi calcium homeostasis and Ca(2+)-regulated signal transduction events. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.7 kDa |
AA Sequence : | MPPSGPRGTLLLLPLLLLLLLRAVLAVPLERGAPNKEETPATESPDTGLYYHRYLQEVIDVLETDGHFRE KLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMDAEQDPNVQVDHLNLLKQFEH LDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLEEQQ RRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPK NEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWETVEMHPAYTEEELRRF EEELAAREAELNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQL KFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | NUCB1 nucleobindin 1 [ Homo sapiens (human) ] |
Official Symbol | NUCB1 |
Synonyms | NUC; CALNUC |
Gene ID | 4924 |
mRNA Refseq | NM_006184.6 |
Protein Refseq | NP_006175.2 |
MIM | 601323 |
UniProt ID | Q02818 |
◆ Recombinant Proteins | ||
NUCB1-28431TH | Recombinant Human NUCB1, His-tagged | +Inquiry |
NUCB1-6244M | Recombinant Mouse NUCB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUCB1-4748H | Recombinant Human NUCB1 Protein (Glu37-Leu461), N-His tagged | +Inquiry |
NUCB1-1394H | Recombinant Human NUCB1, His-tagged | +Inquiry |
NUCB1-4109R | Recombinant Rat NUCB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUCB1-3659HCL | Recombinant Human NUCB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUCB1 Products
Required fields are marked with *
My Review for All NUCB1 Products
Required fields are marked with *
0
Inquiry Basket