Recombinant Full Length Human NUMB Protein, C-Flag-tagged
Cat.No. : | NUMB-911HFL |
Product Overview : | Recombinant Full Length Human NUMB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 70.6 kDa |
AA Sequence : | MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERK FFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWI CHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAKREEIM KQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGF PALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPM TKPVTVVAPQSPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTS QPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQ TFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQR TNPSPTNPFSSDLQKTFEIELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Notch signaling pathway |
Full Length : | Full L. |
Gene Name | NUMB NUMB endocytic adaptor protein [ Homo sapiens (human) ] |
Official Symbol | NUMB |
Synonyms | S171; C14orf41; c14_5527 |
Gene ID | 8650 |
mRNA Refseq | NM_001005743.2 |
Protein Refseq | NP_001005743.1 |
MIM | 603728 |
UniProt ID | P49757 |
◆ Recombinant Proteins | ||
NUMB-10985M | Recombinant Mouse NUMB Protein | +Inquiry |
NUMB-237H | Recombinant Human NUMB protein, His-tagged | +Inquiry |
NUMB-5232H | Recombinant Human NUMB Protein (Leu376-Phe482), N-His tagged | +Inquiry |
NUMB-3808Z | Recombinant Zebrafish NUMB | +Inquiry |
NUMB-01H | Recombinant Human NUMB endocytic adaptor protein Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUMB-3634HCL | Recombinant Human NUMB 293 Cell Lysate | +Inquiry |
NUMB-3635HCL | Recombinant Human NUMB 293 Cell Lysate | +Inquiry |
NUMB-3636HCL | Recombinant Human NUMB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUMB Products
Required fields are marked with *
My Review for All NUMB Products
Required fields are marked with *
0
Inquiry Basket