Recombinant Full Length Human OARD1 Protein, GST-tagged

Cat.No. : OARD1-7017HF
Product Overview : Recombinant Human full-length OARD1(1 a.a. - 152 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 152 amino acids
Description : The protein encoded by this gene is a deacylase that can convert O-acetyl-ADP-ribose to ADP-ribose and acetate, O-propionyl-ADP-ribose to ADP-ribose and propionate, and O-butyryl-ADP-ribose to ADP-ribose and butyrate. The ADP-ribose product is able to inhibit these reactions through a competitive feedback loop.
Molecular Mass : 43.12 kDa
AA Sequence : MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDG RYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVY TL
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name OARD1 O-acyl-ADP-ribose deacylase 1 [ Homo sapiens (human) ]
Official Symbol OARD1
Synonyms OARD1; TARG1; C6orf130; dJ34B21.3; O-acyl-ADP-ribose deacylase 1; O-acetyl-ADP-ribose deacetylase 1; O-acetyl-ADP-ribose deacetylase C6orf130; terminal ADP-ribose protein glycohydrolase 1
Gene ID 221443
mRNA Refseq NM_145063
Protein Refseq NP_659500
MIM 614393
UniProt ID Q9Y530

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OARD1 Products

Required fields are marked with *

My Review for All OARD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon