Recombinant Full Length Human OARD1 Protein, GST-tagged

• Cat.No.: OARD1-7017HF
• Product Overview: Recombinant Human full-length OARD1(1 a.a. - 152 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 152 amino acids
• Description: The protein encoded by this gene is a deacylase that can convert O-acetyl-ADP-ribose to ADP-ribose and acetate, O-propionyl-ADP-ribose to ADP-ribose and propionate, and O-butyryl-ADP-ribose to ADP-ribose and butyrate. The ADP-ribose product is able to inhibit these reactions through a competitive feedback loop.
• Molecular Mass: 43.12 kDa
• AA Sequence: MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDG RYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVY TL
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: OARD1 O-acyl-ADP-ribose deacylase 1 [ Homo sapiens (human) ]
• Official Symbol: OARD1
• Synonyms: OARD1; TARG1; C6orf130; dJ34B21.3; O-acyl-ADP-ribose deacylase 1; O-acetyl-ADP-ribose deacetylase 1; O-acetyl-ADP-ribose deacetylase C6orf130; terminal ADP-ribose protein glycohydrolase 1
• Gene ID: 221443
• mRNA Refseq: NM_145063
• Protein Refseq: NP_659500
• MIM: 614393
• UniProt ID: Q9Y530