Recombinant Full Length Human OBP2B Protein, C-Flag-tagged
Cat.No. : | OBP2B-1895HFL |
Product Overview : | Recombinant Full Length Human OBP2B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable small molecule binding activity. Predicted to be involved in chemosensory behavior. Predicted to be located in extracellular region. Predicted to be active in extracellular space. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 19.3 kDa |
AA Sequence : | MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGKLEATFTFMR EDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREAL EEFKKLVQRKGLSEEDIFTPLQTGSCVPEH myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | OBP2B odorant binding protein 2B [ Homo sapiens (human) ] |
Official Symbol | OBP2B |
Synonyms | LCN14; OBPIIb |
Gene ID | 29989 |
mRNA Refseq | NM_014581.4 |
Protein Refseq | NP_055396.1 |
MIM | 604606 |
UniProt ID | Q9NPH6 |
◆ Recombinant Proteins | ||
OBP2B-701H | Recombinant Human OBP2B Protein, Fc-tagged | +Inquiry |
OBP2B-5207H | Recombinant Human OBP2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OBP2B-01H | Recombinat dog odorant binding protein 2B protein, His tagged. | +Inquiry |
OBP2B-1895HFL | Recombinant Full Length Human OBP2B Protein, C-Flag-tagged | +Inquiry |
OBP2B-702H | Recombinant Human OBP2B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OBP2B-3608HCL | Recombinant Human OBP2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OBP2B Products
Required fields are marked with *
My Review for All OBP2B Products
Required fields are marked with *
0
Inquiry Basket