Recombinant Full Length Human OLIG1 Protein, C-Flag-tagged
Cat.No. : | OLIG1-1425HFL |
Product Overview : | Recombinant Full Length Human OLIG1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in neuron differentiation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within neuron fate commitment. Predicted to be part of chromatin. Predicted to be active in nucleus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.7 kDa |
AA Sequence : | MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAR EKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHC QGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGP PDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | OLIG1 oligodendrocyte transcription factor 1 [ Homo sapiens (human) ] |
Official Symbol | OLIG1 |
Synonyms | BHLHB6; BHLHE21 |
Gene ID | 116448 |
mRNA Refseq | NM_138983.3 |
Protein Refseq | NP_620450.2 |
MIM | 606385 |
UniProt ID | Q8TAK6 |
◆ Recombinant Proteins | ||
OLIG1-1425HFL | Recombinant Full Length Human OLIG1 Protein, C-Flag-tagged | +Inquiry |
Olig1-4589M | Recombinant Mouse Olig1 Protein, Myc/DDK-tagged | +Inquiry |
OLIG1-2930Z | Recombinant Zebrafish OLIG1 | +Inquiry |
OLIG1-2551H | Recombinant Human OLIG1 Protein (17-105 aa), His-tagged | +Inquiry |
OLIG1-779H | Recombinant Human OLIG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLIG1-3577HCL | Recombinant Human OLIG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OLIG1 Products
Required fields are marked with *
My Review for All OLIG1 Products
Required fields are marked with *
0
Inquiry Basket