Recombinant Full Length Human OTUD5 Protein, C-Flag-tagged
Cat.No. : | OTUD5-2009HFL |
Product Overview : | Recombinant Full Length Human OTUD5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the OTU (ovarian tumor) domain-containing cysteine protease superfamily. The OTU domain confers deubiquitinase activity and the encoded protein has been shown to suppress the type I interferon-dependent innate immune response by cleaving the polyubiquitin chain from an essential type I interferon adaptor protein. Cleavage results in disassociation of the adaptor protein from a downstream signaling complex and disruption of the type I interferon signaling cascade. Alternatively spliced transcript variants encoding different isoforms have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60.4 kDa |
AA Sequence : | MTILPKKKPPPPDADPANEPPPPGPMPPAPRRGGGVGVGGGGTGVGGGDRDRDSGVVGARPRASPPPQGP LPGPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAAAAGVGAAGVVVGVGGAVGVG GCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDK KGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHG NHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGL GLPSFKPGFAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQ VRGPSQPRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALAKPPSP CAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPSAFGLNDWDDDEILASVLAVSQQEYLDSMKKN KVHRDPPPDKS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Protease |
Protein Pathways : | RIG-I-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | OTUD5 OTU deubiquitinase 5 [ Homo sapiens (human) ] |
Official Symbol | OTUD5 |
Synonyms | DUBA; MCAND |
Gene ID | 55593 |
mRNA Refseq | NM_017602.4 |
Protein Refseq | NP_060072.1 |
MIM | 300713 |
UniProt ID | Q96G74 |
◆ Recombinant Proteins | ||
OTUD5-12242M | Recombinant Mouse OTUD5 Protein | +Inquiry |
OTUD5-0376H | Recombinant Human OTUD5 Protein (G172-G351), His/Flag tagged | +Inquiry |
OTUD5-4022H | Recombinant Human OTUD5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OTUD5-165H | Active Recombinant Human OTUD5, GST-tagged | +Inquiry |
OTUD5-3881R | Recombinant Rat OTUD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OTUD5 Products
Required fields are marked with *
My Review for All OTUD5 Products
Required fields are marked with *
0
Inquiry Basket