Recombinant Full Length Human P2RX7 Protein, GST-tagged
Cat.No. : | P2RX7-6868HF |
Product Overview : | Human P2RX7 full-length ORF ( AAH11913.1, 1 a.a. - 595 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 595 amino acids |
Description : | The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Multiple alternatively spliced variants have been identified, most of which fit nonsense-mediated decay (NMD) criteria. |
Molecular Mass : | 94.9 kDa |
AA Sequence : | MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVHEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | P2RX7 purinergic receptor P2X 7 [ Homo sapiens (human) ] |
Official Symbol | P2RX7 |
Synonyms | P2RX7; purinergic receptor P2X 7; P2X7; P2X purinoceptor 7; ATP receptor; P2X7 receptor; P2Z receptor; purinergic receptor P2X, ligand gated ion channel, 7; purinergic receptor P2X7 variant A; purnergic receptor P2X 7 |
Gene ID | 5027 |
mRNA Refseq | NM_002562 |
Protein Refseq | NP_002553 |
MIM | 602566 |
UniProt ID | Q99572 |
◆ Recombinant Proteins | ||
P2RX7-9888Z | Recombinant Zebrafish P2RX7 | +Inquiry |
P2RX7-3635H | Recombinant Human P2RX7 protein, His-tagged | +Inquiry |
P2RX7-3894R | Recombinant Rat P2RX7 Protein, His (Fc)-Avi-tagged | +Inquiry |
P2RX7-1494H | Recombinant Human P2RX7, GST-tagged | +Inquiry |
P2RX7-4779H | Recombinant Human P2RX7 Protein (Asp356-Tyr595), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
P2RX7-3495HCL | Recombinant Human P2RX7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All P2RX7 Products
Required fields are marked with *
My Review for All P2RX7 Products
Required fields are marked with *
0
Inquiry Basket