Recombinant Human P2RX7 protein, His-tagged
Cat.No. : | P2RX7-3635H |
Product Overview : | Recombinant Human P2RX7 protein(382-589 aa), fused to His tag, was expressed in E. coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 382-589 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | YYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | P2RX7 purinergic receptor P2X, ligand-gated ion channel, 7 [ Homo sapiens ] |
Official Symbol | P2RX7 |
Synonyms | P2RX7; purinergic receptor P2X, ligand-gated ion channel, 7; P2X purinoceptor 7; MGC20089; P2X7; ATP receptor; P2Z receptor; P2X7 receptor; purinergic receptor P2X7 variant A; |
Gene ID | 5027 |
mRNA Refseq | NM_002562 |
Protein Refseq | NP_002553 |
MIM | 602566 |
UniProt ID | Q99572 |
◆ Recombinant Proteins | ||
P2RX7-4779H | Recombinant Human P2RX7 Protein (Asp356-Tyr595), N-His tagged | +Inquiry |
P2RX7-3894R | Recombinant Rat P2RX7 Protein, His (Fc)-Avi-tagged | +Inquiry |
P2RX7-6868HF | Recombinant Full Length Human P2RX7 Protein, GST-tagged | +Inquiry |
P2RX7-1494H | Recombinant Human P2RX7, GST-tagged | +Inquiry |
P2RX7-391H | Recombinant Human P2RX7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
P2RX7-3495HCL | Recombinant Human P2RX7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All P2RX7 Products
Required fields are marked with *
My Review for All P2RX7 Products
Required fields are marked with *