Recombinant Full Length Human PADI1 Protein, C-Flag-tagged
Cat.No. : | PADI1-1850HFL |
Product Overview : | Recombinant Full Length Human PADI1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type I enzyme is involved in the late stages of epidermal differentiation, where it deiminates filaggrin and keratin K1, which maintains hydration of the stratum corneum, and hence the cutaneous barrier function. This enzyme may also play a role in hair follicle formation. This gene exists in a cluster with four other paralogous genes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 74.5 kDa |
AA Sequence : | MAPKRVVQLSLKMPTHAVCVVGVEAHVDIHSDVPKGANSFRVSGSSGVEVFMVYNRTRVKEPIGKARWPL DTDADMVVSVGTASKELKDFKVRVSYFGEQEDQALGRSVLYLTGVDISLEVDTGRTGKVKRSQGDKKTWR WGPEGYGAILLVNCDRDNHRSAEPDLTHSWLMSLADLQDMSPMLLSCNGPDKLFDSHKLVLNVPFSDSKR VRVFCARGGNSLSDYKQVLGPQCLSYEVERQPGEQEIKFYVEGLTFPDADFLGLVSLSVSLVDPGTLPEV TLFTDTVGFRMAPWIMTPNTQPPEELYVCRVMDTHGSNEKFLEDMSYLTLKANCKLTICPQVENRNDRWI QDEMEFGYIEAPHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIPLPGPSSLDSFGNLDVSPPVTV GGTEYPLGRILIGSSFPKSGGRQMARAVRNFLKAQQVQAPVELYSDWLSVGHVDEFLTFVPTSDQKGFRL LLASPSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWNRNVLKRELGL AESDIVDIPQLFFLKNFYAEAFFPDMVNMVVLGKYLGIPKPYGPIINGRCCLEEKVQSLLEPLGLHCIFI DDYLSYHELQGEIHCGTNVRRKPFPFKWWNMVP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | PADI1 peptidyl arginine deiminase 1 [ Homo sapiens (human) ] |
Official Symbol | PADI1 |
Synonyms | PDI; PAD1; PDI1; HPAD10 |
Gene ID | 29943 |
mRNA Refseq | NM_013358.3 |
Protein Refseq | NP_037490.2 |
MIM | 607934 |
UniProt ID | Q9ULC6 |
◆ Recombinant Proteins | ||
Padi1-4651M | Recombinant Mouse Padi1 Protein, Myc/DDK-tagged | +Inquiry |
PADI1-1727H | Recombinant Human PADI1 Protein (1-663 aa), His-tagged | +Inquiry |
PADI1-863H | Recombinant Human PADI1 | +Inquiry |
PADI1-011H | Recombinant Human PADI1 Protein, His-tagged | +Inquiry |
PADI1-3781H | Recombinant Human PADI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PADI1-3471HCL | Recombinant Human PADI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PADI1 Products
Required fields are marked with *
My Review for All PADI1 Products
Required fields are marked with *
0
Inquiry Basket