Recombinant Full Length Human Palmitoyltransferase Zdhhc2(Zdhhc2) Protein, His-Tagged
| Cat.No. : | RFL22062HF |
| Product Overview : | Recombinant Full Length Human Palmitoyltransferase ZDHHC2(ZDHHC2) Protein (Q9UIJ5) (1-367aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-367) |
| Form : | Lyophilized powder |
| AA Sequence : | MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYH LLFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTR TMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSL LYCLFIAATDLQYFIKFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNK STLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTCLVNQ DPEQASTPAGLNSTAKNLENHQFPAKPLRESQSHLLTDSQSWTESSINPGKCKAGMSNPA LTMENET |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ZDHHC2 |
| Synonyms | ZDHHC2; REAM; REC; ZNF372; Palmitoyltransferase ZDHHC2; Acyltransferase ZDHHC2; Reduced expression associated with metastasis protein; Ream; Reduced expression in cancer protein; Rec; Zinc finger DHHC domain-containing protein 2; DHHC-2; Zinc finger prote |
| UniProt ID | Q9UIJ5 |
| ◆ Recombinant Proteins | ||
| Zdhhc2-7071M | Recombinant Mouse Zdhhc2 Protein, Myc/DDK-tagged | +Inquiry |
| ZDHHC2-3413H | Recombinant Human ZDHHC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ZDHHC2-3793H | Recombinant Human ZDHHC2 protein, GST-tagged | +Inquiry |
| RFL573MF | Recombinant Full Length Mouse Palmitoyltransferase Zdhhc2(Zdhhc2) Protein, His-Tagged | +Inquiry |
| ZDHHC2-18786M | Recombinant Mouse ZDHHC2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZDHHC2-193HCL | Recombinant Human ZDHHC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZDHHC2 Products
Required fields are marked with *
My Review for All ZDHHC2 Products
Required fields are marked with *




