Recombinant Full Length Human PAX8 Protein

Species :	Human
Source :	In Vitro Cell Free System
Protein Length :	451 amino acids
Description :	This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described.
Form :	Liquid
Molecular Mass :	75.240kDa inclusive of tags
AA Sequence :	MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
Purity :	Proprietary Purification
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer :	pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Name	PAX8 paired box 8 [ Homo sapiens ]
Official Symbol	PAX8
Synonyms	PAX8; paired box 8; Paired box gene 8; Paired box protein Pax-8
Gene ID	7849
mRNA Refseq	NM_003466
Protein Refseq	NP_003457
MIM	167415
UniProt ID	Q06710