Recombinant Full Length Human PCYT1A Protein, C-Flag-tagged
Cat.No. : | PCYT1A-549HFL |
Product Overview : | Recombinant Full Length Human PCYT1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to the cytidylyltransferase family and is involved in the regulation of phosphatidylcholine biosynthesis. Mutations in this gene are associated with spondylometaphyseal dysplasia with cone-rod dystrophy. Alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.6 kDa |
AA Sequence : | MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRG TPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCR YVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIV RDYDVYARRNLQRGYTAKELNVSFINEKKYHLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEE KSREFIGSFLEMFGPEGALKHMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPAN LSRHKAAAYDISEDEEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Glycerophospholipid metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | PCYT1A phosphate cytidylyltransferase 1A, choline [ Homo sapiens (human) ] |
Official Symbol | PCYT1A |
Synonyms | CT; CTA; CCTA; CTPCT; PCYT1; SMDCRD; CCTalpha |
Gene ID | 5130 |
mRNA Refseq | NM_005017.4 |
Protein Refseq | NP_005008.2 |
MIM | 123695 |
UniProt ID | P49585 |
◆ Recombinant Proteins | ||
PCYT1A-29484TH | Recombinant Human PCYT1A | +Inquiry |
Pcyt1a-4724M | Recombinant Mouse Pcyt1a Protein, Myc/DDK-tagged | +Inquiry |
PCYT1A-1623H | Recombinant Human PCYT1A Protein, His (Fc)-Avi-tagged | +Inquiry |
PCYT1A-787H | Recombinant Human PCYT1A protein, GST-tagged | +Inquiry |
PCYT1A-4314R | Recombinant Rat PCYT1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCYT1A-3366HCL | Recombinant Human PCYT1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCYT1A Products
Required fields are marked with *
My Review for All PCYT1A Products
Required fields are marked with *
0
Inquiry Basket