Recombinant Full Length Human PDCD1LG2 Protein, C-Flag-tagged
| Cat.No. : | PDCD1LG2-1020HFL |
| Product Overview : | Recombinant Full Length Human PDCD1LG2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Involved in negative regulation of activated T cell proliferation; negative regulation of interferon-gamma production; and negative regulation of interleukin-10 production. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. Biomarker of pulmonary tuberculosis. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 30.8 kDa |
| AA Sequence : | MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Transmembrane |
| Protein Pathways : | Cell adhesion molecules (CAMs) |
| Full Length : | Full L. |
| Gene Name | PDCD1LG2 programmed cell death 1 ligand 2 [ Homo sapiens (human) ] |
| Official Symbol | PDCD1LG2 |
| Synonyms | B7DC; Btdc; PDL2; CD273; PD-L2; PDCD1L2; bA574F11.2 |
| Gene ID | 80380 |
| mRNA Refseq | NM_025239.4 |
| Protein Refseq | NP_079515.2 |
| MIM | 605723 |
| UniProt ID | Q9BQ51 |
| ◆ Recombinant Proteins | ||
| Pdcd1lg2-112M | Active Recombinant Mouse Pdcd1lg2, MIgG2a Fc-tagged | +Inquiry |
| PDCD1LG2-5190H | Recombinant Human PDCD1LG2 Protein (Leu20-Pro219), C-Fc tagged | +Inquiry |
| PDCD1LG2-827HF | Recombinant Human PDCD1LG2 Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
| PDCD1LG2-132H | Recombinant Human PDCD1LG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PDCD1LG2-3340R | Recombinant Rhesus monkey PDCD1LG2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDCD1LG2-2721HCL | Recombinant Human PDCD1LG2 cell lysate | +Inquiry |
| PDCD1LG2-1738MCL | Recombinant Mouse PDCD1LG2 cell lysate | +Inquiry |
| PDCD1LG2-951CCL | Recombinant Cynomolgus PDCD1LG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD1LG2 Products
Required fields are marked with *
My Review for All PDCD1LG2 Products
Required fields are marked with *
