Recombinant Full Length Human PDCD1LG2 Protein, C-Flag-tagged

Cat.No. : PDCD1LG2-1020HFL
Product Overview : Recombinant Full Length Human PDCD1LG2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Involved in negative regulation of activated T cell proliferation; negative regulation of interferon-gamma production; and negative regulation of interleukin-10 production. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. Biomarker of pulmonary tuberculosis.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 30.8 kDa
AA Sequence : MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHR ERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVE LTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQ
SQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Transmembrane
Protein Pathways : Cell adhesion molecules (CAMs)
Full Length : Full L.
Gene Name PDCD1LG2 programmed cell death 1 ligand 2 [ Homo sapiens (human) ]
Official Symbol PDCD1LG2
Synonyms B7DC; Btdc; PDL2; CD273; PD-L2; PDCD1L2; bA574F11.2
Gene ID 80380
mRNA Refseq NM_025239.4
Protein Refseq NP_079515.2
MIM 605723
UniProt ID Q9BQ51

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDCD1LG2 Products

Required fields are marked with *

My Review for All PDCD1LG2 Products

Required fields are marked with *

0
cart-icon