Recombinant Full Length Human PDCD2L Protein, GST-tagged

• Cat.No.: PDCD2L-6141HF
• Product Overview: Human MGC13096 full-length ORF ( NP_115722.1, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 358 amino acids
• Description: PDCD2L (Programmed Cell Death 2 Like) is a Protein Coding gene. An important paralog of this gene is ENSG00000266953.
• Molecular Mass: 65.8 kDa
• AA Sequence: MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPTSEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQEDPDELLFK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PDCD2L programmed cell death 2-like [ Homo sapiens ]
• Official Symbol: PDCD2L
• Synonyms: PDCD2L; programmed cell death 2-like; programmed cell death protein 2-like; MGC13096
• Gene ID: 84306
• mRNA Refseq: NM_032346
• Protein Refseq: NP_115722
• MIM: 615661
• UniProt ID: Q9BRP1