Recombinant Human PDCD2L Protein, GST-tagged
Cat.No. : | PDCD2L-4355H |
Product Overview : | Human MGC13096 full-length ORF ( NP_115722.1, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | PDCD2L (Programmed Cell Death 2 Like) is a Protein Coding gene. An important paralog of this gene is ENSG00000266953. |
Molecular Mass : | 65.8 kDa |
AA Sequence : | MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPTSEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQEDPDELLFK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PDCD2L programmed cell death 2-like [ Homo sapiens ] |
Official Symbol | PDCD2L |
Synonyms | PDCD2L; programmed cell death 2-like; programmed cell death protein 2-like; MGC13096; |
Gene ID | 84306 |
mRNA Refseq | NM_032346 |
Protein Refseq | NP_115722 |
UniProt ID | Q9BRP1 |
◆ Recombinant Proteins | ||
PDCD2L-4355H | Recombinant Human PDCD2L Protein, GST-tagged | +Inquiry |
PDCD2L-151H | Recombinant Human PDCD2L Protein, His-tagged | +Inquiry |
PDCD2L-4830H | Recombinant Human PDCD2L protein, GST-tagged | +Inquiry |
PDCD2L-2285C | Recombinant Chicken PDCD2L | +Inquiry |
Pdcd2l-4733M | Recombinant Mouse Pdcd2l Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDCD2L-3361HCL | Recombinant Human PDCD2L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD2L Products
Required fields are marked with *
My Review for All PDCD2L Products
Required fields are marked with *