"PDCD2L" Related Products

Expand

Recombinant Human PDCD2L Protein, GST-tagged

Cat.No. : PDCD2L-4355H
Product Overview : Human MGC13096 full-length ORF ( NP_115722.1, 1 a.a. - 358 a.a.) recombinant protein with GST-tag at N-terminal.
Description : PDCD2L (Programmed Cell Death 2 Like) is a Protein Coding gene. An important paralog of this gene is ENSG00000266953.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 65.8 kDa
AA Sequence : MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPTSEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQEDPDELLFK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : PDCD2L programmed cell death 2-like [ Homo sapiens ]
Official Symbol : PDCD2L
Synonyms : PDCD2L; programmed cell death 2-like; programmed cell death protein 2-like; MGC13096;
Gene ID : 84306
mRNA Refseq : NM_032346
Protein Refseq : NP_115722
UniProt ID : Q9BRP1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.