Recombinant Full Length Human PECR Protein, C-Flag-tagged
Cat.No. : | PECR-56HFL |
Product Overview : | Recombinant Full Length Human PECR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Participates in chain elongation of fatty acids. Has no 2,4-dienoyl-CoA reductase activity. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.4 kDa |
AA Sequence : | MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTK QARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCK AVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAV ENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNW PKGAGDLSVVKKMKETFKEKAKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Biosynthesis of unsaturated fatty acids |
Full Length : | Full L. |
Gene Name | PECR peroxisomal trans-2-enoyl-CoA reductase [ Homo sapiens (human) ] |
Official Symbol | PECR |
Synonyms | TERP; DCRRP; PVIARL; HPDHASE; SDR29C1; HSA250303 |
Gene ID | 55825 |
mRNA Refseq | NM_018441.6 |
Protein Refseq | NP_060911.2 |
MIM | 605843 |
UniProt ID | Q9BY49 |
◆ Recombinant Proteins | ||
PECR-2493H | Recombinant Human Peroxisomal Erans-2-Enoyl-CoA Reductase, His-tagged | +Inquiry |
PECR-6171H | Recombinant Human PECR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PECR-56HFL | Recombinant Full Length Human PECR Protein, C-Flag-tagged | +Inquiry |
PECR-1638H | Recombinant Human PECR, His-tagged | +Inquiry |
PECR-4370R | Recombinant Rat PECR Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PECR-3309HCL | Recombinant Human PECR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PECR Products
Required fields are marked with *
My Review for All PECR Products
Required fields are marked with *