Recombinant Full Length Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp11(Fkbp11) Protein, His-Tagged
Cat.No. : | RFL11808HF |
Product Overview : | Recombinant Full Length Human Peptidyl-prolyl cis-trans isomerase FKBP11(FKBP11) Protein (Q9NYL4) (28-201aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (28-201) |
Form : | Lyophilized powder |
AA Sequence : | GLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIEL GQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRAN YWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FKBP11 |
Synonyms | FKBP11; FKBP19; UNQ336/PRO535; Peptidyl-prolyl cis-trans isomerase FKBP11; PPIase FKBP11; 19 kDa FK506-binding protein; 19 kDa FKBP; FKBP-19; FK506-binding protein 11; FKBP-11; Rotamase |
UniProt ID | Q9NYL4 |
◆ Recombinant Proteins | ||
FKBP11-4184H | Recombinant Human FKBP11 Protein, GST-tagged | +Inquiry |
FKBP11-4791HF | Recombinant Full Length Human FKBP11 Protein, GST-tagged | +Inquiry |
RFL17516BF | Recombinant Full Length Bovine Peptidyl-Prolyl Cis-Trans Isomerase Fkbp11(Fkbp11) Protein, His-Tagged | +Inquiry |
FKBP11-3265M | Recombinant Mouse FKBP11 Protein, His (Fc)-Avi-tagged | +Inquiry |
FKBP11-95H | Recombinant Human FKBP11 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP11-6212HCL | Recombinant Human FKBP11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP11 Products
Required fields are marked with *
My Review for All FKBP11 Products
Required fields are marked with *