Recombinant Full Length Human PFKFB4 Protein, C-Flag-tagged
Cat.No. : | PFKFB4-1636HFL |
Product Overview : | Recombinant Full Length Human PFKFB4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is one of four bifunctional kinase/phosphatases that regulate the concentration of the glycolytic byproduct fructose-2,6-bisphosphate (F2,6BP). The encoded protein is highly expressed in cancer cells and is induced by hypoxia. This protein is essential to the survival of cancer cells under conditions of hypoxia, because it increases the amount of F2,6BP and ATP at a time when the cell cannot produce much of them. This finding suggests that this protein may be a good target for disruption in cancer cells, hopefully imperiling their survival. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.9 kDa |
AA Sequence : | MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLTRYLNWIGVPT REFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSEEGGHVAVFDATNTTRERRAT IFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEDLD RDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGRE FAKSLAQFISDQNIKDLKVWTSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFAL RDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTV LKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAHQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Fructose and mannose metabolism |
Full Length : | Full L. |
Gene Name | PFKFB4 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 [ Homo sapiens (human) ] |
Official Symbol | PFKFB4 |
Synonyms | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase-4; bifunctional enzyme with kinase and biphosphatase activities; 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 |
Gene ID | 5210 |
mRNA Refseq | NM_004567.4 |
Protein Refseq | NP_004558.1 |
MIM | 605320 |
UniProt ID | Q16877 |
◆ Recombinant Proteins | ||
PFKFB4-526C | Recombinant Cynomolgus Monkey PFKFB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFKFB4-1636HFL | Recombinant Full Length Human PFKFB4 Protein, C-Flag-tagged | +Inquiry |
PFKFB4-216H | Recombinant Human PFKFB4, GST-tagged | +Inquiry |
PFKFB4-3505Z | Recombinant Zebrafish PFKFB4 | +Inquiry |
PFKFB4-4393R | Recombinant Rat PFKFB4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFKFB4-3274HCL | Recombinant Human PFKFB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFKFB4 Products
Required fields are marked with *
My Review for All PFKFB4 Products
Required fields are marked with *
0
Inquiry Basket