Recombinant Full Length Human PGLYRP1 Protein, C-Flag-tagged
Cat.No. : | PGLYRP1-164HFL |
Product Overview : | Recombinant Full Length Human PGLYRP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Binds also to Gram-negative bacteria, and has bacteriostatic activity towards Gram-negative bacteria. Plays a role in innate immunity. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.6 kDa |
AA Sequence : | MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTP ASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVP TPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | PGLYRP1 peptidoglycan recognition protein 1 [ Homo sapiens (human) ] |
Official Symbol | PGLYRP1 |
Synonyms | PGRP; TAG7; PGRPS; PGLYRP; PGRP-S; TNFSF3L |
Gene ID | 8993 |
mRNA Refseq | NM_005091.3 |
Protein Refseq | NP_005082.1 |
MIM | 604963 |
UniProt ID | O75594 |
◆ Recombinant Proteins | ||
PGLYRP1-5268H | Recombinant Human PGLYRP1 Protein (Gln22-Pro196), N-His tagged | +Inquiry |
Pglyrp1-6666M | Recombinant Mouse Pglyrp1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGLYRP1-1667H | Recombinant Human PGLYRP1 protein, His-tagged | +Inquiry |
PGLYRP1-3334H | Recombinant Human PGLYRP1 protein, His&Myc-tagged | +Inquiry |
Pglyrp1-571M | Recombinant Mouse PGLYRP1 protein(Met1-Glu182), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGLYRP1-1339HCL | Recombinant Human PGLYRP1 cell lysate | +Inquiry |
PGLYRP1-1873MCL | Recombinant Mouse PGLYRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGLYRP1 Products
Required fields are marked with *
My Review for All PGLYRP1 Products
Required fields are marked with *