Recombinant Full Length Human PGM3 Protein, C-Flag-tagged
Cat.No. : | PGM3-2037HFL |
Product Overview : | Recombinant Full Length Human PGM3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the phosphohexose mutase family. The encoded protein mediates both glycogen formation and utilization by catalyzing the interconversion of glucose-1-phosphate and glucose-6-phosphate. A non-synonymous single nucleotide polymorphism in this gene may play a role in resistance to diabetic nephropathy and neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 59.7 kDa |
AA Sequence : | MDLGAITKYSALHAKPNGLILQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVMVTASHNPEED NGVKLVDPLGEMLAPSWEEHATCLANAEEQDMQRVLIDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSV IDGVTVLGGQFHDYGLLTTPQLHYMVYCRNTGGRYGKATIEGYYQKLSKAFVELTKQASCSGDEYRSLKV DCANGIGALKLREMEHYFSQGLSVQLFNDGSKGKLNHLCGADFVKSHQKPPQGMEIKSNERCCSFDGDAD RIVYYYHDADGHFHLIDGDKIATLISSFLKELLVEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTK TGVKHLHHKAQEFDIGVYFEANGHGTALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAI SDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTNAERQAVTPPGLQEAINDLVKKYKL SRAFVRPSGTEDVVRVYAEADSQESADHLAHEVSLAVFQLAGGIGERPQPGF myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Amino sugar and nucleotide sugar metabolism |
Full Length : | Full L. |
Gene Name | PGM3 phosphoglucomutase 3 [ Homo sapiens (human) ] |
Official Symbol | PGM3 |
Synonyms | AGM1; PAGM; IMD23; PGM 3 |
Gene ID | 5238 |
mRNA Refseq | NM_015599.3 |
Protein Refseq | NP_056414.1 |
MIM | 172100 |
UniProt ID | O95394 |
◆ Recombinant Proteins | ||
PGM3-1665H | Recombinant Human PGM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGM3-1694H | Recombinant Human PGM3 protein, His & T7-tagged | +Inquiry |
PGM3-717H | Recombinant Human PGM3 Protein (1-542 aa), His-SUMO-tagged | +Inquiry |
Pgm3-1695M | Recombinant Mouse Pgm3 protein, His & T7-tagged | +Inquiry |
Pgm3-435M | Recombinant Mouse Pgm3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGM3-3249HCL | Recombinant Human PGM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGM3 Products
Required fields are marked with *
My Review for All PGM3 Products
Required fields are marked with *
0
Inquiry Basket