Recombinant Full Length Human PGRMC1 Protein, C-Flag-tagged

• Cat.No.: PGRMC1-2055HFL
• Product Overview: Recombinant Full Length Human PGRMC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 21.5 kDa
• AA Sequence: MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKR RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD DLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: PGRMC1 progesterone receptor membrane component 1 [ Homo sapiens (human) ]
• Official Symbol: PGRMC1
• Synonyms: IZA; MPR; Dap1; HPR6.6
• Gene ID: 10857
• mRNA Refseq: NM_006667.5
• Protein Refseq: NP_006658.1
• MIM: 300435
• UniProt ID: O00264