Recombinant Full Length Human PGRMC1 Protein, C-Flag-tagged
Cat.No. : | PGRMC1-2055HFL |
Product Overview : | Recombinant Full Length Human PGRMC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.5 kDa |
AA Sequence : | MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKR RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD DLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Nuclear Hormone Receptor, Transmembrane |
Full Length : | Full L. |
Gene Name | PGRMC1 progesterone receptor membrane component 1 [ Homo sapiens (human) ] |
Official Symbol | PGRMC1 |
Synonyms | IZA; MPR; Dap1; HPR6.6 |
Gene ID | 10857 |
mRNA Refseq | NM_006667.5 |
Protein Refseq | NP_006658.1 |
MIM | 300435 |
UniProt ID | O00264 |
◆ Recombinant Proteins | ||
PGRMC1-4071R | Recombinant Rat PGRMC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGRMC1-6674M | Recombinant Mouse PGRMC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL13935MF | Recombinant Full Length Mouse Membrane-Associated Progesterone Receptor Component 1(Pgrmc1) Protein, His-Tagged | +Inquiry |
PGRMC1-4411R | Recombinant Rat PGRMC1 Protein | +Inquiry |
PGRMC1-413H | Recombinant Human PGRMC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGRMC1-3248HCL | Recombinant Human PGRMC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGRMC1 Products
Required fields are marked with *
My Review for All PGRMC1 Products
Required fields are marked with *
0
Inquiry Basket