Recombinant Full Length Human PHB Protein
| Cat.No. : | PHB-371HF |
| Product Overview : | Recombinant full length Human Prohibitin with an N terminal proprietary tag; Predicted MWt 55.66 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 272 amino acids |
| Description : | Prohibitin is an evolutionarily conserved gene that is ubiquitously expressed.It is thought to be a negative regulator of cell proliferation and may be a tumor suppressor.Mutations in PHB have been linked to sporadic breast cancer.Prohibitin is expressed as two transcripts with varying lengths of 3 untranslated region.The longer transcript is present at higher levels in proliferating tissues and cells, suggesting that this longer 3 untranslated region may function as a trans-acting regulatory RNA. |
| Form : | Liquid |
| Molecular Mass : | 55.660kDa inclusive of tags |
| AA Sequence : | MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFD RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVIT GSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLP SITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAAT FGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVV EKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK LEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | PHB prohibitin [ Homo sapiens ] |
| Official Symbol | PHB |
| Synonyms | PHB; prohibitin; PHB1 |
| Gene ID | 5245 |
| mRNA Refseq | NM_002634 |
| Protein Refseq | NP_002625 |
| MIM | 176705 |
| UniProt ID | P35232 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHB Products
Required fields are marked with *
My Review for All PHB Products
Required fields are marked with *
