Recombinant Full Length Human PHB Protein
Cat.No. : | PHB-371HF |
Product Overview : | Recombinant full length Human Prohibitin with an N terminal proprietary tag; Predicted MWt 55.66 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 272 amino acids |
Description : | Prohibitin is an evolutionarily conserved gene that is ubiquitously expressed.It is thought to be a negative regulator of cell proliferation and may be a tumor suppressor.Mutations in PHB have been linked to sporadic breast cancer.Prohibitin is expressed as two transcripts with varying lengths of 3 untranslated region.The longer transcript is present at higher levels in proliferating tissues and cells, suggesting that this longer 3 untranslated region may function as a trans-acting regulatory RNA. |
Form : | Liquid |
Molecular Mass : | 55.660kDa inclusive of tags |
AA Sequence : | MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFD RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVIT GSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLP SITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAAT FGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVV EKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK LEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PHB prohibitin [ Homo sapiens ] |
Official Symbol | PHB |
Synonyms | PHB; prohibitin; PHB1 |
Gene ID | 5245 |
mRNA Refseq | NM_002634 |
Protein Refseq | NP_002625 |
MIM | 176705 |
UniProt ID | P35232 |
◆ Recombinant Proteins | ||
PHB-3855B | Recombinant Burkholderia pickettii PHB protein, His-tagged | +Inquiry |
Phb-4996M | Recombinant Mouse Phb protein | +Inquiry |
PHB-4417R | Recombinant Rat PHB Protein | +Inquiry |
Phb-4832M | Recombinant Mouse Phb Protein, Myc/DDK-tagged | +Inquiry |
PHB-2606M | Recombinant Mouse PHB Protein (41-173 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHB-3241HCL | Recombinant Human PHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHB Products
Required fields are marked with *
My Review for All PHB Products
Required fields are marked with *
0
Inquiry Basket