Recombinant Full Length Human PHYHIPL Protein, C-Flag-tagged
| Cat.No. : | PHYHIPL-2139HFL |
| Product Overview : | Recombinant Full Length Human PHYHIPL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Located in cytoplasm. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 42.3 kDa |
| AA Sequence : | MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDGNKSQDSGIAEMEELPVPHNIKISNITCDSFKISW EMDSKSKDRITHYFIDLNKKENKNSNKFKHKDVPTKLVAKAVPLPMTVRGHWFLSPRTEYTVAVQTASKQ VDGDYVVSEWSEIIEFCTADYSKVHLTQLLEKAEVIAGRMLKFSVFYRNQHKEYFDYVREHHGNAMQPSV KDNSGSHGSPISGKLEGIFFSCSTEFNTGKPPQDSPYGRYRFEIAAEKLFNPNTNLYFGDFYCMYTAYHY VILVIAPVGSPGDEFCKQRLPQLNSKDNKFLTCTEEDGVLVYHHAQDVILEVIYTDPVDLSLGTVAEITG HQLMSLSTANAKKDPSCKTCNISVGR myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | PHYHIPL phytanoyl-CoA 2-hydroxylase interacting protein like [ Homo sapiens (human) ] |
| Official Symbol | PHYHIPL |
| Synonyms | KIAA1796 |
| Gene ID | 84457 |
| mRNA Refseq | NM_032439.4 |
| Protein Refseq | NP_115815.2 |
| UniProt ID | Q96FC7 |
| ◆ Recombinant Proteins | ||
| PHYHIPL-4721H | Recombinant Human PHYHIPL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Phyhipl-4846M | Recombinant Mouse Phyhipl Protein, Myc/DDK-tagged | +Inquiry |
| PHYHIPL-1671H | Recombinant Human PHYHIPL Protein, His (Fc)-Avi-tagged | +Inquiry |
| PHYHIPL-4096R | Recombinant Rat PHYHIPL Protein, His (Fc)-Avi-tagged | +Inquiry |
| PHYHIPL-1696H | Recombinant Human PHYHIPL, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PHYHIPL-3210HCL | Recombinant Human PHYHIPL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHYHIPL Products
Required fields are marked with *
My Review for All PHYHIPL Products
Required fields are marked with *
