Recombinant Full Length Human PHYKPL Protein, GST-tagged
| Cat.No. : | PHYKPL-6146HF |
| Product Overview : | Human MGC15875 full-length ORF ( ENSP00000321290, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 175 amino acids |
| Description : | This is a nuclear gene encoding a mitochondrial enzyme that catalyzes the conversion of 5-phosphonooxy-L-lysine to ammonia, inorganic phosphate, and 2-aminoadipate semialdehyde. Mutations in this gene may cause phosphohydroxylysinuria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013] |
| Molecular Mass : | 45.3 kDa |
| AA Sequence : | MGKSIGNGHPVACVAATQPVARAFEATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEKVRSCETLRLQP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PHYKPL 5-phosphohydroxy-L-lysine phospho-lyase [ Homo sapiens (human) ] |
| Official Symbol | PHYKPL |
| Synonyms | PHYKPL; 5-phosphohydroxy-L-lysine phospho-lyase; PHLU; AGXT2L2 |
| Gene ID | 85007 |
| mRNA Refseq | NM_153373 |
| Protein Refseq | NP_699204 |
| MIM | 614683 |
| UniProt ID | Q8IUZ5 |
| ◆ Recombinant Proteins | ||
| Phykpl-4847M | Recombinant Mouse Phykpl Protein, Myc/DDK-tagged | +Inquiry |
| PHYKPL-3548Z | Recombinant Zebrafish PHYKPL | +Inquiry |
| PHYKPL-721H | Recombinant Human PHYKPL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PHYKPL-6146HF | Recombinant Full Length Human PHYKPL Protein, GST-tagged | +Inquiry |
| PHYKPL-4351H | Recombinant Human PHYKPL Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHYKPL Products
Required fields are marked with *
My Review for All PHYKPL Products
Required fields are marked with *
