Recombinant Full Length Human PI3 Protein, C-Flag-tagged
Cat.No. : | PI3-1204HFL |
Product Overview : | Recombinant Full Length Human PI3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 9.9 kDa |
AA Sequence : | MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVS TKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | PI3 peptidase inhibitor 3 [ Homo sapiens (human) ] |
Official Symbol | PI3 |
Synonyms | ESI; WAP3; SKALP; WFDC14; cementoin |
Gene ID | 5266 |
mRNA Refseq | NM_002638.4 |
Protein Refseq | NP_002629.1 |
MIM | 182257 |
UniProt ID | P19957 |
◆ Recombinant Proteins | ||
PI3-3419R | Recombinant Rhesus monkey PI3 Protein, His-tagged | +Inquiry |
PI3-02H | Recombinant Human PI3 protein, His-tagged | +Inquiry |
PI3-95H | Recombinant Human PI3, His-tagged | +Inquiry |
PI3-3340H | Recombinant Human PI3 protein, His-SUMO-tagged | +Inquiry |
PI3-3237R | Recombinant Rhesus Macaque PI3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PI3-2035HCL | Recombinant Human PI3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PI3 Products
Required fields are marked with *
My Review for All PI3 Products
Required fields are marked with *
0
Inquiry Basket