Recombinant Full Length Human PIP4K2A Protein, C-Flag-tagged
Cat.No. : | PIP4K2A-1719HFL |
Product Overview : | Recombinant Full Length Human PIP4K2A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility. The protein encoded by this gene is one of a family of enzymes capable of catalyzing the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. The amino acid sequence of this enzyme does not show homology to other kinases, but the recombinant protein does exhibit kinase activity. This gene is a member of the phosphatidylinositol-5-phosphate 4-kinase family. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46 kDa |
AA Sequence : | MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVMLMPDDFKAYS KIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDK RYIIKTITSEDVAEMHNILKKYHQYIVECHGITLLPQFLGMYRLNVDGVEIYVIVTRNVFSHRLSVYRKY DLKGSTVAREASDKEKAKELPTLKDNDFINEGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGI HDVERAEQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRK EVYFMAIIDILTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHILTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | PIP4K2A phosphatidylinositol-5-phosphate 4-kinase type 2 alpha [ Homo sapiens (human) ] |
Official Symbol | PIP4K2A |
Synonyms | PIPK; PI5P4KA; PIP5K2A; PIP5KIIA; PIP5KII-alpha |
Gene ID | 5305 |
mRNA Refseq | NM_005028.5 |
Protein Refseq | NP_005019.2 |
MIM | 603140 |
UniProt ID | P48426 |
◆ Recombinant Proteins | ||
PIP4K2A-1719HFL | Recombinant Full Length Human PIP4K2A Protein, C-Flag-tagged | +Inquiry |
Pip4k2a-4873M | Recombinant Mouse Pip4k2a Protein, Myc/DDK-tagged | +Inquiry |
PIP4K2A-6753M | Recombinant Mouse PIP4K2A Protein, His (Fc)-Avi-tagged | +Inquiry |
PIP4K2A-3937H | Recombinant Human PIP4K2A protein, His-tagged | +Inquiry |
PIP4K2A-4912H | Recombinant Human PIP4K2A Protein (Met1-Thr406), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIP4K2A-3175HCL | Recombinant Human PIP4K2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIP4K2A Products
Required fields are marked with *
My Review for All PIP4K2A Products
Required fields are marked with *
0
Inquiry Basket