Recombinant Full Length Human PIPOX Protein, C-Flag-tagged

Cat.No. : PIPOX-1184HFL
Product Overview : Recombinant Full Length Human PIPOX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables L-pipecolate oxidase activity and sarcosine oxidase activity. Involved in L-lysine catabolic process to acetyl-CoA via L-pipecolate. Located in peroxisome.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 43.9 kDa
AA Sequence : MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYLEDFYTRMMHE CYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCLSSEELKQRFPNIRLPRGEVG LLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTSRSYQAKSLVITAGPWTNQLL RPLGIEMPLQTLRINVCYWREMVPGSYGVSQAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADP EERDCPTARTDIGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG
FKLAPVVGKILYELSMKLTPSYDLAPFRISRFPSLGKAHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Transmembrane
Protein Pathways : Glycine, serine and threonine metabolism, Lysine degradation, Metabolic pathways
Full Length : Full L.
Gene Name PIPOX pipecolic acid and sarcosine oxidase [ Homo sapiens (human) ]
Official Symbol PIPOX
Synonyms LPIPOX
Gene ID 51268
mRNA Refseq NM_016518.3
Protein Refseq NP_057602.2
MIM 616713
UniProt ID Q9P0Z9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIPOX Products

Required fields are marked with *

My Review for All PIPOX Products

Required fields are marked with *

0

Inquiry Basket

cartIcon