Recombinant Full Length Human PIPOX Protein, C-Flag-tagged
Cat.No. : | PIPOX-1184HFL |
Product Overview : | Recombinant Full Length Human PIPOX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables L-pipecolate oxidase activity and sarcosine oxidase activity. Involved in L-lysine catabolic process to acetyl-CoA via L-pipecolate. Located in peroxisome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43.9 kDa |
AA Sequence : | MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYLEDFYTRMMHE CYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCLSSEELKQRFPNIRLPRGEVG LLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTSRSYQAKSLVITAGPWTNQLL RPLGIEMPLQTLRINVCYWREMVPGSYGVSQAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADP EERDCPTARTDIGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG FKLAPVVGKILYELSMKLTPSYDLAPFRISRFPSLGKAHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Glycine, serine and threonine metabolism, Lysine degradation, Metabolic pathways |
Full Length : | Full L. |
Gene Name | PIPOX pipecolic acid and sarcosine oxidase [ Homo sapiens (human) ] |
Official Symbol | PIPOX |
Synonyms | LPIPOX |
Gene ID | 51268 |
mRNA Refseq | NM_016518.3 |
Protein Refseq | NP_057602.2 |
MIM | 616713 |
UniProt ID | Q9P0Z9 |
◆ Recombinant Proteins | ||
Pipox-4876M | Recombinant Mouse Pipox Protein, Myc/DDK-tagged | +Inquiry |
PIPOX-1685H | Recombinant Human PIPOX Protein, His (Fc)-Avi-tagged | +Inquiry |
PIPOX-1729H | Recombinant Human PIPOX, GST-tagged | +Inquiry |
PIPOX-2184H | Recombinant Human PIPOX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PIPOX-1184HFL | Recombinant Full Length Human PIPOX Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIPOX-3170HCL | Recombinant Human PIPOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIPOX Products
Required fields are marked with *
My Review for All PIPOX Products
Required fields are marked with *
0
Inquiry Basket