Recombinant Full Length Human PKDCC Protein, GST-tagged
| Cat.No. : | PKDCC-5940HF |
| Product Overview : | Human LOC91461 full-length ORF ( NP_612379.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 294 amino acids |
| Description : | PKDCC (Protein Kinase Domain Containing, Cytoplasmic) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and non-membrane spanning protein tyrosine kinase activity. |
| Molecular Mass : | 59.7 kDa |
| AA Sequence : | MVLLERLRHPNVLQLYGYCYQDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLDDARVEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQYLQNSTASSSTEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTTYVKASG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PKDCC protein kinase domain containing, cytoplasmic [ Homo sapiens (human) ] |
| Official Symbol | PKDCC |
| Synonyms | PKDCC; protein kinase domain containing, cytoplasmic; Vlk; SGK493; extracellular tyrosine-protein kinase PKDCC; protein kinase domain containing, cytoplasmic homolog; protein kinase domain-containing protein, cytoplasmic; protein kinase-like protein SgK493; sugen kinase 493; vertebrate lonesome kinase; EC 2.7.10.2 |
| Gene ID | 91461 |
| mRNA Refseq | NM_138370 |
| Protein Refseq | NP_612379 |
| MIM | 614150 |
| UniProt ID | Q504Y2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PKDCC Products
Required fields are marked with *
My Review for All PKDCC Products
Required fields are marked with *



