Recombinant Full Length Human PKDCC Protein, GST-tagged
| Cat.No. : | PKDCC-5940HF | 
| Product Overview : | Human LOC91461 full-length ORF ( NP_612379.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 294 amino acids | 
| Description : | PKDCC (Protein Kinase Domain Containing, Cytoplasmic) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and non-membrane spanning protein tyrosine kinase activity. | 
| Molecular Mass : | 59.7 kDa | 
| AA Sequence : | MVLLERLRHPNVLQLYGYCYQDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLDDARVEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQYLQNSTASSSTEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTTYVKASG | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | PKDCC protein kinase domain containing, cytoplasmic [ Homo sapiens (human) ] | 
| Official Symbol | PKDCC | 
| Synonyms | PKDCC; protein kinase domain containing, cytoplasmic; Vlk; SGK493; extracellular tyrosine-protein kinase PKDCC; protein kinase domain containing, cytoplasmic homolog; protein kinase domain-containing protein, cytoplasmic; protein kinase-like protein SgK493; sugen kinase 493; vertebrate lonesome kinase; EC 2.7.10.2 | 
| Gene ID | 91461 | 
| mRNA Refseq | NM_138370 | 
| Protein Refseq | NP_612379 | 
| MIM | 614150 | 
| UniProt ID | Q504Y2 | 
| ◆ Recombinant Proteins | ||
| PKDCC-5940HF | Recombinant Full Length Human PKDCC Protein, GST-tagged | +Inquiry | 
| PKDCC-01H | Recombinant Human PKDCC Protein, GST-tagged | +Inquiry | 
| PKDCC-12863M | Recombinant Mouse PKDCC Protein | +Inquiry | 
| Pkdcc-5788M | Recombinant Mouse Pkdcc protein, His-tagged | +Inquiry | 
| Pkdcc-2319M | Recombinant Mouse Pkdcc protein, His&Myc-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| PKDCC-1025HCL | Recombinant Human PKDCC cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All PKDCC Products
Required fields are marked with *
My Review for All PKDCC Products
Required fields are marked with *
  
        
    
      
            