Recombinant Full Length Human PLA1A Protein, C-Flag-tagged
Cat.No. : | PLA1A-1143HFL |
Product Overview : | Recombinant Full Length Human PLA1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a phospholipase that hydrolyzes fatty acids at the sn-1 position of phosphatidylserine and 1-acyl-2-lysophosphatidylserine. This secreted protein hydrolyzes phosphatidylserine in liposomes. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.5 kDa |
AA Sequence : | MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLKVQFLLFVPSNPSCGQLVEGS SDLQNSGFNATLGTKLIIHGFRVLGTKPSWIDTFIRTLLRATNANVIAVDWIYGSTGVYFSAVKNVIKLS LEISLFLNKLLVLGVSESSIHIIGVSLGAHVGGMVGQLFGGQLGQITGLDPAGPEYTRASVEERLDAGDA LFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAF PCASYKAFLAGRCLDCFNPFLLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKEL RNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFC TALLPVNDREKMVCLPEPVNLQASVTVSCDLKIACVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | PLA1A phospholipase A1 member A [ Homo sapiens (human) ] |
Official Symbol | PLA1A |
Synonyms | PSPLA1; PS-PLA1 |
Gene ID | 51365 |
mRNA Refseq | NM_015900.4 |
Protein Refseq | NP_056984.1 |
MIM | 607460 |
UniProt ID | Q53H76 |
◆ Recombinant Proteins | ||
PLA1A-168H | Recombinant Human PLA1A, His-tagged | +Inquiry |
PLA1A-1883H | Recombinant Human PLA1A Protein, MYC/DDK-tagged | +Inquiry |
PLA1A-4143R | Recombinant Rat PLA1A Protein, His (Fc)-Avi-tagged | +Inquiry |
PLA1A-4483R | Recombinant Rat PLA1A Protein | +Inquiry |
PLA1A-12882M | Recombinant Mouse PLA1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA1A-1366HCL | Recombinant Human PLA1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLA1A Products
Required fields are marked with *
My Review for All PLA1A Products
Required fields are marked with *
0
Inquiry Basket