Recombinant Full Length Human PLA2G15 Protein, C-Flag-tagged
Cat.No. : | PLA2G15-409HFL |
Product Overview : | Recombinant Full Length Human PLA2G15 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. This enzyme is present in the plasma and thought to be associated with high-density lipoprotein. A later paper contradicts the function of this gene. It demonstrates that this gene encodes a lysosomal enzyme instead of a lysophospholipase and has both calcium-independent phospholipase A2 and transacylase activities. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.5 kDa |
AA Sequence : | MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTE SYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHT MVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQR QPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEK VFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDR DPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Protein Pathways : | Glycerophospholipid metabolism, Lysosome |
Full Length : | Full L. |
Gene Name | PLA2G15 phospholipase A2 group XV [ Homo sapiens (human) ] |
Official Symbol | PLA2G15 |
Synonyms | ACS; LLPL; LPLA2; LYPLA3; GXVPLA2 |
Gene ID | 23659 |
mRNA Refseq | NM_012320.4 |
Protein Refseq | NP_036452.1 |
MIM | 609362 |
UniProt ID | Q8NCC3 |
◆ Recombinant Proteins | ||
PLA2G15-295C | Recombinant Chinese hamster PLA2G15 protein, His-tagged | +Inquiry |
PLA2G15-6795M | Recombinant Mouse PLA2G15 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLA2G15-1247D | Recombinant Dog PLA2G15 protein, His-tagged | +Inquiry |
PLA2G15-2522M | Recombinant Mouse PLA2G15 Protein (34-412 aa), His-Myc-tagged | +Inquiry |
PLA2G15-2592H | Recombinant Human PLA2G15 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G15-3144HCL | Recombinant Human PLA2G15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLA2G15 Products
Required fields are marked with *
My Review for All PLA2G15 Products
Required fields are marked with *
0
Inquiry Basket