Recombinant Full Length Human PLA2G15 Protein, GST-tagged
| Cat.No. : | PLA2G15-6243HF |
| Product Overview : | Human LYPLA3 full-length ORF ( NP_036452.1, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 412 amino acids |
| Description : | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. This enzyme is present in the plasma and thought to be associated with high-density lipoprotein. A later paper contradicts the function of this gene. It demonstrates that this gene encodes a lysosomal enzyme instead of a lysophospholipase and has both calcium-independent phospholipase A2 and transacylase activities. [provided by RefSeq |
| Molecular Mass : | 73.1 kDa |
| AA Sequence : | MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PLA2G15 phospholipase A2, group XV [ Homo sapiens ] |
| Official Symbol | PLA2G15 |
| Synonyms | PLA2G15; phospholipase A2, group XV; LYPLA3, lysophospholipase 3 (lysosomal phospholipase A2); group XV phospholipase A2; GXVPLA2; LLPL; 1-O-acylceramide synthase; lysosomal phospholipase A2; LCAT-like lysophospholipase; lysophospholipase 3 (lysosomal phospholipase A2); ACS; LPLA2; LYPLA3; DKFZp564A0122; |
| Gene ID | 23659 |
| mRNA Refseq | NM_012320 |
| Protein Refseq | NP_036452 |
| MIM | 609362 |
| UniProt ID | Q8NCC3 |
| ◆ Recombinant Proteins | ||
| PLA2G15-1750H | Recombinant Human PLA2G15, GST-tagged | +Inquiry |
| PLA2G15-12885M | Recombinant Mouse PLA2G15 Protein | +Inquiry |
| Pla2g15-1945M | Recombinant Mouse Pla2g15 Protein, His-tagged | +Inquiry |
| PLA2G15-4145R | Recombinant Rat PLA2G15 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLA2G15-6243HF | Recombinant Full Length Human PLA2G15 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLA2G15-3144HCL | Recombinant Human PLA2G15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G15 Products
Required fields are marked with *
My Review for All PLA2G15 Products
Required fields are marked with *
